PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim12g017370.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 352aa    MW: 39443.4 Da    PI: 8.072
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim12g017370.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-333286155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Sopim12g017370.0.1 32 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 86
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-322987IPR009057Homeodomain-like
PROSITE profilePS5129412.3472989IPR017930Myb domain
SuperFamilySSF466891.58E-163187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-233287IPR006447Myb domain, plants
PfamPF002491.1E-73484IPR001005SANT/Myb domain
PfamPF143793.3E-22128167IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MFHAKKPSTM NSHDRPMCVQ GDSGLVLTTD PKPRLRWTVE LHERFVDAVT QLGGPDKATP  60
KTIMRVMGVK GLTLYHLKSH LQKFRLGKQP HKEFNDHSVK DGDRATSLEL QRNSASSSGM  120
IGRNMNEMQM EVQRRLHEQL EVQRHLQLRI EAQGKYMQTI LEKACQTLGG EENMSLPTRT  180
FKGIGNHQGG LIPDISAAFK EFGTPPLTFS SFQDLNICGE HIDLHAQSSM GERSSSFDGF  240
MNLSNTSTDH NLSLGKKRAS PYNTSNGKSP FMWSDDFRLH ELGSNNEDDH QIIQMERSCN  300
PEIDSVSDMY ESKPLLQDDK KFDTKPERPS PRRAAQVSSL SAQGGRNSVF G*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010313970.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK51e-128APL_ARATH; Myb family transcription factor APL
TrEMBLK4DD700.0K4DD70_SOLLC; Uncharacterized protein
STRINGSolyc12g017370.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79422231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-130G2-like family protein